Choose a country to view content specific to your location
Defensins are small cationic peptides produced by neutrophils and epithelial cells, playing a crucial role in the innate immune response due to their antimicrobial properties. Recent studies have linked single nucleotide polymorphisms (SNPs) in beta-defensins to an increased susceptibility to cancer. Specifically, downregulation of beta-defensins has been observed in oral cancer, indicating a potential tumor-suppressive role.
Contact us to learn more about Meridian’s molecular or immunoassay reagent portfolio. We want to hear from you!
| Name | Type | Format | Host/Source | Isotype | Tested Apps | Unit | Catalog | Buffer | Immunogen | Recombinant | Description | Notes | Safety Data Sheet | COA/Test Release | Product Information Sheet | New Product | Recommended Product | Order a Sample | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| MAb to Beta Defensin-2 (4-41) | Monoclonal | Purified | Mouse | IgG1 | EIA | MG | P24011M | Lyophilized from Phosphate Buffered Saline, pH 7.4. | Synthetic human beta-Defensin 2 (a.a. 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). | No | MAb to beta-Defensin-2 (a.a 4-41) Monoclonal Antibody to Human beta-Defensin-2 (Amino Acids 4-41) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Beta-defensin-1 Aa 1-36 | Monoclonal | Purified | Mouse | IgG1 | EIA,WB | MG | P24141M | Lyophilized from PBS, pH 7.4. | Synthetic human beta-Defensin 1 (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). | No | MAb to beta-Defensin-1 (a.a. 1-36) Monoclonal Antibody to Human Defensin beta-1 (amino acids 1-36). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 |
Not seeing what you’re looking for? Inquire about a new product
Have questions about a product? Want to learn more about Meridian’s molecular or immunoassay reagent portfolio? We want to hear from you!
By submitting your information in this form, you agree that your personal information may be stored and processed in any country where we have facilities or service providers, and by using our “Contact Us” page you agree to the transfer of information to countries outside of your country of residence, including to the United States, which may provide for different data protection rules than in your country. The information you submit will be governed by our Privacy Statement.
| Type |
|---|
| Format |
| Host/Source |
| Isotype |
| Tested Apps |
| Unit |
| Catalog |
| Buffer |
| Immunogen |
| COFA Description |
| COFA Notes |
| Recombination |
| SDS |
| COA |
| Product Information Sheet |
| Request Sample |