Choose a country to view content specific to your location

Defensin

Defensins are small cationic peptides produced by neutrophils and epithelial cells, playing a crucial role in the innate immune response due to their antimicrobial properties. Recent studies have linked single nucleotide polymorphisms (SNPs) in beta-defensins to an increased susceptibility to cancer. Specifically, downregulation of beta-defensins has been observed in oral cancer, indicating a potential tumor-suppressive role.

Have questions about a product?

Contact us to learn more about Meridian’s molecular or immunoassay reagent portfolio. We want to hear from you!

Product Filters
Type
Recombinant
Format
Host/Source
Tested Apps
Clear All

Defensin Products (2)

Filters Close
NameTypeFormatHost/SourceIsotypeTested AppsUnitCatalogBufferImmunogenRecombinantDescriptionNotesSafety Data SheetCOA/Test ReleaseProduct Information SheetNew ProductRecommended ProductOrder a Sample
MAb to Beta Defensin-2 (4-41) MonoclonalPurifiedMouseIgG1EIAMGP24011MLyophilized from Phosphate Buffered Saline, pH 7.4.Synthetic human beta-Defensin 2 (a.a. 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP).NoMAb to beta-Defensin-2 (a.a 4-41) Monoclonal Antibody to Human beta-Defensin-2 (Amino Acids 4-41)Safety Data Sheet
COA/Test Release0
MAb to Beta-defensin-1 Aa 1-36 MonoclonalPurifiedMouseIgG1EIA,WBMGP24141MLyophilized from PBS, pH 7.4.Synthetic human beta-Defensin 1 (a.a. 1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK).NoMAb to beta-Defensin-1 (a.a. 1-36) Monoclonal Antibody to Human Defensin beta-1 (amino acids 1-36).Safety Data Sheet
COA/Test Release0

Not seeing what you’re looking for? Inquire about a new product

Interested to learn more about COVID/Flu/RSV multiplex testing?

Get in Touch With A Specialist

Have questions about a product? Want to learn more about Meridian’s molecular or immunoassay reagent portfolio? We want to hear from you!

By submitting your information in this form, you agree that your personal information may be stored and processed in any country where we have facilities or service providers, and by using our “Contact Us” page you agree to the transfer of information to countries outside of your country of residence, including to the United States, which may provide for different data protection rules than in your country. The information you submit will be governed by our Privacy Statement.

Get In Touch With Us

Order a Sample